PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_87695g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 166aa    MW: 19176.2 Da    PI: 10.1703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_87695g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-142267146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+WT eEd +l+ +++++G g+W+  a+  g++Rt+ +c++rw +
    MA_87695g0010 22 KGPWTVEEDVQLKGYIHLHGEGRWSFLAKAAGLKRTGRSCRLRWVN 67
                     79******************************************87 PP

2Myb_DNA-binding47.44.5e-1577118346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + T+eE+ l ++++ ++G++ W+ Iar ++ gRt++++k++w++
    MA_87695g0010  77 KITPEEERLMIELHGRWGNR-WSHIARSLP-GRTDNEIKNYWRT 118
                      56******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8011769IPR017930Myb domain
SuperFamilySSF466894.03E-2920116IPR009057Homeodomain-like
SMARTSM007174.4E-122171IPR001005SANT/Myb domain
PfamPF002499.9E-132267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-212376IPR009057Homeodomain-like
CDDcd001671.08E-82469No hitNo description
PROSITE profilePS5129422.83270124IPR017930Myb domain
SMARTSM007171.3E-1274122IPR001005SANT/Myb domain
PfamPF002492.9E-1377118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2277124IPR009057Homeodomain-like
CDDcd001672.42E-1079120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MANRTWSGVS EVEDEDQAET RKGPWTVEED VQLKGYIHLH GEGRWSFLAK AAGLKRTGRS  60
CRLRWVNSLR PDLKHSKITP EEERLMIELH GRWGNRWSHI ARSLPGRTDN EIKNYWRTRL  120
KGKLNLKSQS SGGIDVDNPV HFERSRRSHC LPTSSQRPPD HDGAEX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-26191241105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-261912424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468714.14e-52PREDICTED: transcription factor MYB24
RefseqXP_006448450.14e-52hypothetical protein CICLE_v10015986mg
SwissprotP813916e-52MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0D6QR058e-55A0A0D6QR05_ARACU; Uncharacterized protein
STRINGGLYMA16G07960.12e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.17e-52myb domain protein 116